Navigation Links
AGU journal highlights -- Aug. 6, 2009
Date:8/6/2009

The Southern Ocean plays an important role in mitigating climate change because it acts as a sink of atmospheric carbon dioxide. Most current models predict that the strength of the Southern Ocean carbon dioxide sink should increase as atmospheric carbon dioxide rises, but observations show that this has not been the case. To help resolve this discrepancy, Lenton et al. consider the effects of stratospheric ozone depletion, which most previous studies had not included. They compare coupled carbon-climate models with and without ozone depletion and find that including ozone depletion produced a significant reduction in Southern Ocean carbon uptake, in good agreement with observed trends. The simulations show that ozone depletion, combined with increased atmospheric greenhouse gas concentration, drives stronger winds above the Southern Ocean. These stronger winds bring more carbon-rich deep water to the surface, which reduces the ocean's ability to absorb more carbon dioxide from the atmosphere. The authors also find that ozone depletion increases ocean acidification. They suggest that future climate models should take stratospheric ozone into account.

Title: Stratospheric ozone depletion reduces ocean carbon uptake and enhances ocean acidification

Authors: Andrew Lenton and Nicolas Metzl: LOCEAN, IPSL, UPMC, MHNH, IRD, CNRS, Paris, France;

Francis Codron: LMD, IPSL, UPMC, X, ENS, CNRS, Paris, France;

Laurent Bopp, Patricia Cadule, and Alessandro Tagliabue: LSCE, IPSL, CEA, UVSQ, CNRS, Gif-sur-Yvette, France;

Julien Le Sommer: LEGI, UJF, INPG, CNRS, Grenoble, France.

Source: Geophysical Research Letters (GRL) paper 10.1029/2009GL038227, 2009; http://dx.doi.org/10.1029/2009GL038227


2. Study pinpoints sources of Earth's "hum"

The Earth emits a continuous low-frequency vibration, or "hum," that is not attributable t
'/>"/>

Contact: Maria-Jose Vinas
mjvinas@agu.org
202-777-7530
American Geophysical Union
Source:Eurekalert

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13

Related biology news :

1. News tips from the Journal of Neuroscience
2. Tips from the Journals of the American Society for Microbiology
3. Story ideas from the Journal of Lipid Research
4. Highlights from the September 2007 Journal of the American Dietetic Association
5. AGU journal highlights -- Sept. 6, 2007
6. Springer will publish Journal of Coastal Conservation
7. ESA celebrates 100 years of insect science journals
8. Springer and the New York Botanical Garden Press join forces to publish botanical journals
9. 200 journals join in theme issues on poverty and human development
10. New ETH Zurich article published in scientific journal Nature
11. Media highlights in the November issues of Biophysical Journal
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... --  News Highlights: , ... Partners Data Lake, an agile data and analytics ... allow researcher and clinicians to explore and develop ... of patients , The Partners Data Lake ... Partners system, breaking down physical barriers for collaboration ...
(Date:11/15/2014)... -- While we may still be a few years away from ... to gain instant access to all that ailed his patients, ... tablets for monitoring and measuring our health are cropping up ... a tad Orwellian to some, but a new survey suggests ... opportunities into their healthcare regime. These are some ...
(Date:11/10/2014)... appearing on U.S. store shelves in early 2010, and ... The small packets can be tossed into a washing ... or powder. The convenience, though, has come with risks ... at Nationwide Children,s Hospital found that from 2012 through ... children younger than 6 years of age swallowing, inhaling, ...
Breaking Biology News(10 mins):Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 2Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 3Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 4Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 5Americans May Be Ready for a Brave New World of Healthcare 2Americans May Be Ready for a Brave New World of Healthcare 3Americans May Be Ready for a Brave New World of Healthcare 4Study finds laundry detergent pods, serious poisoning risk for children 2
... For the first time, researchers have confirmed an association ... and abnormalities on brain MRI, according to a new ... The new study raises the possibility that a toxic ... body long after administration. Brain MRI exams ...
... Peterhans, a Roosevelt University professor and adjunct curator at ... mammals in Africa, has announced the discovery of four ... of the Democratic Republic of Congo. , The mammals ... led by the Wildlife Conservation Society (WCS) and in ...
... of millions of Americans, there,s no such thing as the ... hear a constant ringing, buzzing, hissing, humming or other noise ... be debilitating and life-altering. Now, University of Michigan ... what is going on inside their unquiet brains. The ...
Cached Biology News:Contrast agent linked with brain abnormalities on MRI 2Chicago scientist involved in discovery of 4 new mammal species in Democratic Republic of Congo 2U-M tinnitus discovery opens door to possible new treatment avenues 2U-M tinnitus discovery opens door to possible new treatment avenues 3
(Date:11/26/2014)... (PRWEB) November 25, 2014 Miles Holder, ... joined the Graphel Carbon Products team as Sales/Marketing Manager. ... marketing, and customer service for the graphite industry. , ... to our team,” stated Dave Trinkley, VP of Market ... wide range of experience in the graphite industry, along ...
(Date:11/26/2014)... 2014 Theravalues Corporation est fier d,annoncer ... européen au salon Hi Europe 2014 (du 2 ... Curcumine la plus biodisponible actuellement sur ... à des ingrédients approuvés par les règlements européens. ... présent dans la racine de curcuma ( Curcuma ...
(Date:11/24/2014)... Nov. 24, 2014  IGI Laboratories, Inc. (NYSE MKT: ... specialty generic pharmaceutical company, today announced it has submitted ... U.S. Food and Drug Administration (FDA), which brings the ... seven, with eighteen submissions now pending at the FDA. ... CEO of the Company, commented, "Our team here at ...
(Date:11/24/2014)... , November 24, 2014   ... online on ScienceDirect   Elsevier , a ... services, is pleased to announce the launch of the latest ... Current Opinion in Food Science . ... will provide specialists with a new platform to keep up-to-date ...
Breaking Biology Technology:Miles Holder Joins Graphel Corporation as Sales/Marketing Manager 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 3IGI Laboratories, Inc. Announces ANDA Submission 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 3
... Aug. 25 Reportlinker.com announces that a new ... Protein Kinase Therapeutics in Oncology ... http://www.reportlinker.com/p0284973/Protein-Kinase-Therapeutics-in-Oncology---Where-to-Commercialize.html This report comprises defined ... protein kinase drugs (990 projects) within the portfolio ...
... KONG, Aug. 25 bioserie is first to market ... give earth-conscious Apple device owners the protection they demand ... production. bioserie,s unique use of the latest in bioplastics ... and the prevention of environmental toxic pollution once the ...
... meet three goals in the production of biofuels ... production and ecological sustainability. Syracuse University,s Radhakrishna Sureshkumar, ... in the L.C. Smith College of Engineering and ... Satvik Wani have uncovered a process that is ...
Cached Biology Technology:Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 2Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 3Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 4Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 5Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 6Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 7Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 8Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 9Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 10Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 11Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 12Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 13Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 14Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 15Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 16Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 17Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 18Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 19Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 20bioserie Introduces the World's First 'Made of Plants' iPhone 4 Cover 2SU research team uses nanobiotechnology-manipulated light particles to accelerate algae growth 2
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Biology Products: