Navigation Links
A protein could be a key weapon in the battle of the bulge
Date:4/1/2014

Bethesda, MD (April 1, 2014) More than one-third of people in the US are obese. Obesity and its related health problemsincluding high blood pressure, high cholesterol, diabetes, insulin resistance, and belly fataffect so many, yet effective treatments are very few. In a new study, Simon Musyoka Mwangi and colleagues tested whether higher levels of a certain protein help fight the weight gain and health problems caused by eating the wrong foods.

Glial cell line-derived neurotrophic factoror GDNF for shortis a protein integral to keeping the body's systems in balance (homeostasis) and helping develop and maintain the nerve cells responsible for a host of bodily functions such as digestion and muscle control. Previous research has shown that elevated levels of GDNF can lead to weight loss in rodents and primates with age-related obesity and prevent weight gain in younger animals. In this study, researchers looked specifically at how the increased presence of GDNF might affect obesity caused by a high fat diet.

Researchers compared mice bred to have higher levels of GDNF protein with control mice. The mice were fed either a regular rodent diet (containing ~6% fat) or a high-fat diet (~34% fat).They found that the GDNF-mice fed a high-fat diet resisted diet-induced weight gain, visceral (around the organs) fat development, fatty liver, high lipid (fat) levels in the blood, and insulin resistance. The GDNF mice also experienced improved insulin sensitivity and increased calorie burn compared to control mice on a high-fat diet.

More research is needed into how GDNF works in the body, but the data presented by Mwangi et al. suggest that it may cause increased calorie burn in both brown and white fat cells and in muscle tissue. Their research also suggests that GDNF and its receptors may be unique and effective targets for obesity prevention and treatment therapies.

The article "Glial cell line-derived neurotrophic factor protect
'/>"/>

Contact: Stacy Brooks
sbrooks@the-aps.org
301-634-7209
American Physiological Society
Source:Eurekalert

Page: 1 2

Related biology news :

1. IU biologists offer clearer picture of how protein machine systems tweak gene expression
2. Making memories: How 1 protein does it
3. Embryonic development protein active in cancer growth
4. More effective method of imaging proteins
5. The loss of a protein makes jump the tumor to the lymph node
6. Gold nanoantennas detect proteins
7. The Japanese traditional therapy, honokiol, blocks key protein in inflammatory brain damage
8. New hope for treating Alzheimers Disease: A role for the FKBP52 protein
9. Protein jailbreak helps breast cancer cells live
10. Plant research reveals new role for gene silencing protein
11. Newly found protein helps cells build tissues
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/20/2015)... , Mar. 20, 2015 Research and Markets ... addition of the "India Sensors Market Forecast ... The sensor market is projected to ... Consumer electronics, automotive, industrial and healthcare ... in the country. In addition, adoption of MEMS ...
(Date:3/19/2015)... Conn. , March 19, 2015  NXT-ID, Inc. (NASDAQ: ... authentication company focused on the growing mobile commerce market, announces ... in a news clip that aired this week on ... ) . In a segment "The Next Great ... wallet ,a new way to pay, and ,a really big ...
(Date:3/17/2015)...  MecklerMedia Corporation (OTCQX: MECK) announced its ... ever held in New York City ... 2015 at the Javits Convention Center. ... Acorn Product Development; Axis NJ; c-Link Systems; CoroWare; ... NewBotic Corporation; Neya Systems LLC; Reliabotics; RoboKind; RocketFarm ...
Breaking Biology News(10 mins):India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 2India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 3NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 2NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 3MecklerMedia's RoboUniverse New York Announces Sponsors and Exhibitors, May 11-13, 2015 2
... June 10, 2010The ongoing search for evidence of past or ... such as proteins in Martian soil, but their absence to ... happens to these carbon-based molecules is presented in an article ... Mary Ann Liebert, Inc. The article is available free online ...
... CLEMSON, S.C. With a new twist on an ... to store "waste" energy underground to cut heating and cooling ... Molz have received a $991,000 grant from the U.S. Department ... system that can be used as a model for energy ...
... Cornell University researchers recently stretched individual molecules and ... can be used as powerful new tools for nanoscale ... 11 issue of the journal Science, probes ... important when shrinking electronics to their ultimate small size ...
Cached Biology News:New model is proposed to explain absence of organic compounds on surface of Mars 2Clemson engineers to create model underground energy-storage facility 2Clemson engineers to create model underground energy-storage facility 3Stretching molecules yields new understanding of electricity 2
(Date:3/26/2015)... LANSING, Mich., March 26, 2015 Neogen Corporation ... income for the third quarter of fiscal 2015, which ... to the prior year,s $6,575,000. Earnings per share in ... year ago. Current year-to-date net income increased 17% over ... to $20,621,000, or $0.56 per share, for the same ...
(Date:3/26/2015)... 26, 2015 Ale Gicqueau, Founder and ... of Clinical Affairs at Align Technology, on “ Conducting ... upcoming ACRP 2015 Global Conference and Exhibition on April ... , During the poster presentation, Ale Gicqueau and ... running a Postmarket Registry, the requirements and resources to ...
(Date:3/25/2015)... TORONTO , March 25, 2015 /PRNewswire/ - SQI Diagnostics ... announced that, as a result of recent discussions with ... common shares of the Company, after dealing with certain ... and special meeting of shareholders on March 26, 2015 ... that the election of directors will take place when ...
(Date:3/25/2015)... Laboratory workers can turn to ... Balances to get best-performing features while still remaining ... from the trusted brand include: , Cole-Parmer ... efficiency by providing a large weighing surface for ... include parts counting, percent weighing, checkweighing, animal/dynamic weighing, ...
Breaking Biology Technology:Neogen reports 13% increase in net income 2Neogen reports 13% increase in net income 3Neogen reports 13% increase in net income 4Neogen reports 13% increase in net income 5Neogen reports 13% increase in net income 6Neogen reports 13% increase in net income 7Neogen reports 13% increase in net income 8Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 2Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 2SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 4SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 5New Economical Top-Loading and Analytical Symmetry Balances from Cole-Parmer 2
... , a biopharmaceutical company developing cancer therapies, has announced ... been selected for preclinical testing and human clinical trials. ... safety assessment, it would submit to the U.S. ... application in late 2007, with human clinical trials expected ...
... Milwaukee, Wis - Understanding our genetic makeup ... to the point where DNA testing services, including ... shaping their own health management. Patients, however, will ... knowledge because most healthcare facilities are not yet ...
... The drive to make healthcare information technology interoperable ... applications, and a medical information technology company headquartered ... TeraMedica is lending its expertise to developing ... for the healthcare industry. Specifically, the expertise of ...
Cached Biology Technology:Healthcare slow to adopt genetic advances 2Healthcare slow to adopt genetic advances 3TeraMedica embraces open source project 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: