Navigation Links
A once-only cataclysmic event and other mysteries of earth's crust and upper mantle

regions supports the hypothesis that the BIA and northern Alexander terrane formed in the circum-Arctic region. U-Pb and Hf data for Cambrian-Ordovician rocks are similar to values from the Timanides, whereas Silurian-Lower Devonian rocks yield values shared with Caledonian rocks in Baltica and northern Greenland. BIA strata of suspected late Paleozoic age are more juvenile, perhaps recording motion of the Alexander terrane from the circum-Arctic into the paleo-Pacific realm.

Paleotectonics of a complex Miocene half graben formed above a detachment fault: The Diligencia basin, Orocopia Mountains, southern California
Raymond V. Ingersoll et al., Department of Earth, Planetary and Space Sciences, University of California, Los Angeles, California 90095-1567, USA. Published online ahead of print on 2 Apr. 2014;

From the abstract: The Diligencia basin in the Orocopia Mountains of southeastern California has been one of the primary areas used to test the hypothesis of more than 300 km of dextral slip along the combined San Andreas/San Gabriel fault system. The Orocopia Mountains have also been the focus of research on deposition, deformation, metamorphism, uplift and exposure of the Orocopia Schist, which resulted from flat-slab subduction during the latest Cretaceous/Paleogene Laramide orogeny. The uppermost Oligocene/Lower Miocene Diligencia Formation consists of more than 1500 m of nonmarine strata, including 21- to 24-million-year-old basalt flows and intrusions

U-Pb geochronology of 1.1 Ga diabase in the southwestern United States: Testing models for the origin of a post-Grenville large igneous province
Ryan M. Bright et al., Department of Geological Sciences, New Mexico State University, Las Cruces, New Mexico 88003, USA. Published online ahead of print on 2 Apr. 2014;

Contact: Kea Giles
Geological Society of America

Page: 1 2 3 4 5 6 7 8

Related biology news :

1. Key chocolate ingredients could help prevent obesity, diabetes
2. Distinguished researcher to speak at NJIT on preventing bone loss
3. Neck ribs in woolly mammoths provide clues about their decline and eventual extinction
4. Research findings link post-heart attack biological events that provide cardioprotection
5. Fruit flies help uncover tumor-preventing protein complex
6. Diets high in animal protein may help prevent functional decline in elderly individuals
7. Glucosamine fails to prevent deterioration of knee cartilage, decrease pain
8. Healthy midlife diet may prevent dementia later
9. Pretreatment with SSTF prevents hippocampal neuronal apoptosis due to cerebral infarction
10. Abdominal fat accumulation prevented by unsaturated fat
11. Enhancement of chemotherapy by prevention of tumor cell repair
Post Your Comments:
(Date:12/10/2014)... NEW YORK , Dec. 8, 2014 You,ve ... online banking account but can,t remember your password, site key ... birthday? Who was your first grade teacher? ... launches the app that will finally put an ... PINs – 1U TM . 1U leverages a ...
(Date:12/10/2014)... Forest Baptist Medical Center today announced plans for a ... Funding for this $50 million capital project is part ... launched next summer. The medical education ... R.J. Reynolds Tobacco Company complex, adjacent to 525@vine in ... plans to be ready to welcome medical students in ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
Breaking Biology News(10 mins):The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2
... 28, 2008) Just three years after it was discovered, ... to the Wildlife Conservation Society, which recently published the first-ever ... "kipunji," the large, forest-dwelling primate hovers at 1,117 individuals, according ... journal Oryx . The population estimate was ...
... at Houston say they are the first to provide ... may be an autoimmune disease. Their research could provide ... Findings appear online in Nature Medicine on ... Xia, M.D., Ph.D., an assistant professor of biochemistry and ...
... to dangerously low levels in diseases such as anemia ... cells, doctors filter platelets from donated blood, but this ... and cause other side effects in patients who need ... have been trying to generate platelets from embryonic stem ...
Cached Biology News:Pre-eclampsia may be autoimmune disease 2Pre-eclampsia may be autoimmune disease 3
(Date:12/24/2014)... “Preparative & Process Chromatography Market by Instrument ... Buffers, Valves, Guages, Seals), Accessories, Services, End User ... 2019” provides a detailed overview of the major ... strategies impacting the preparative and process chromatography market ... revenue and share analysis. , Full Copy ...
(Date:12/24/2014)... Island, New York (PRWEB) December 23, 2014 ... and the Long Island Affiliate of ITRA Global, the national ... slow but steady recovery. This is evidenced by the ... the strong stock market. Low energy costs have held ... The only negative is the housing market remaining soft. ...
(Date:12/24/2014)... , Dec. 23, 2014 China ... the "Company"), a leading fully integrated plasma-based biopharmaceutical ... announced that its majority-owned subsidiary, Shandong Taibang Biological ... ("GMP") certification from the China Food and Drug ... production facility. As previously disclosed in the Company,s ...
(Date:12/24/2014)... PARIS and NEW YORK ... data from its open-label pilot study of mazindol in ... Design, Development and Therapy in December 2014 . ... of mazindol in children with attention deficit/hyperactivity disorder" ( ... 2014 Dec 1;8:2321-2332. eCollection 2014 ) ...
Breaking Biology Technology:Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 2Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 3Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 4ITRA Global Reports Long Island Is Out of Sync With The National Office Market 2ITRA Global Reports Long Island Is Out of Sync With The National Office Market 3China Biologic Receives GMP Certification for New Coagulation Factor Facility 2China Biologic Receives GMP Certification for New Coagulation Factor Facility 3Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 2Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 3
... Polytechnic Institute Professor James Jian-Qiang Lu was recognized ... toward the design and realization of 3-D integrated ... Department of Electrical, Computer, and Systems Engineering (ECSE) ... D. Ashman Achievement Award for 2010 from the ...
... Intarcia Therapeutics. Inc today announced that Kurt ... presenting at the Lazard Capital Markets 7th Annual ... Tuesday, November 16, 2010 at 1:40pm local time ... (Logo: ) ...
... 11, 2010 StemCyte, Inc., one of the world,s ... is proud to announce that the Company has been ... Internal Revenue Service,s Qualifying Therapeutic Discovery Project (QTDP) program ... than 250 employees. The Patient Protection and ...
Cached Biology Technology:Rensselaer Polytechnic Institute professor James Lu garners award for research on 3-D computer chips 2Intarcia Therapeutics Executive Chairman, Kurt Graves to Present at Lazard Capital Markets 7th Annual Healthcare Conference 2StemCyte Awarded $488,950 for Advanced Therapeutic Applications of Umbilical Cord Blood Stem Cells from the Qualifying Therapeutic Discovery Project (QTDP) 2
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: