Navigation Links
2 new therapies show promise for cancer patients
Date:4/15/2008

San Diego and PhoenixApril 15, 2008Clinical researchers at Scottsdale Healthcare and TGen today announced the results of two clinical trials that show promise for patients battling cancer.

The Phase I clinical trial findings, presented at the this weeks Annual Meeting of the American Association for Cancer Research by Daniel Von Hoff, MD, FACG, focused on basal cell carcinoma (BCC) and pancreatic cancer. The Arizona trials were conducted at TGen's Clinical Research Service (TCRS) at Scottsdale Healthcare, a strategic alliance between TGen and Scottsdale Healthcares Clinical Research Institute.

Basal Cell Carcinoma

In the first trial, a novel molecule, GDC-0449, shrinks tumors in basal cell carcinoma (BCC) while having limited side effects, including a loss of sense of taste, and a small amount of hair loss and weight loss, suggesting a viable new treatment option. GDC-0449 works by blocking a pathway a series of chemical reactions within a cell known as Hedgehog, containing two genes (PTCH and SMO) that lead to a known tumor-promoting gene called GLI1. Alterations in any of these genes have been shown to lead to basal cell carcinoma and other diseases. GDC-0449 is a chemical synthetic designed to replicate the properties of cyclopamine, a chemical found in nature.

Basal cell carcinoma affects about one million people a year and a proportion of these patients have disease that is not curable with surgery. We currently do not have any treatments that can effectively slow tumor growth in these advanced patients. This finding has potential importance in this population, said Daniel D. Von Hoff, M.D., Physician in Chief at the Translational Genomics Research Institute (TGen) and Chief Medical Officer for the Scottsdale Clinical Research Institute at Scottsdale Healthcare.

Typically diagnosed with a simple biopsy, the risk of BCC increases for those individuals with a family history, or prolonged exposure to ultr
'/>"/>

Contact: Galen Perry
gperry@tgen.org
602-343-8423
The Translational Genomics Research Institute
Source:Eurekalert

0

GOOD

Page: 1 2 3

Related biology news :

1. Linchpin gene may be useful target for new breast cancer therapies
2. NCI renewal grant to develop new cancer therapies
3. The construction of heart modelling leads path to new therapies
4. Challenges and promise of cell-based therapies
5. Innovative civil engineering application promises cleaner waters
6. New CPR promises better results by compressing abdomen, not Chest
7. Tiny tubes and rods show promise as catalysts, sunscreen
8. New genetic research into nicotine addiction shows promise for personalized treatment
9. Genetic ancestral testing cannot deliver on its promise, study warns
10. Sweet potato shines as new promise for small enterprise and hunger relief in developing countries
11. Summer-dormant tall fescue grass shows promise for pasture improvements
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
(Date:6/19/2013)... 20, 2013 New programme ... solutions for pharmaceutical and chemical sectors ... Pte. Ltd. and Siemens Pte. Ltd, have signed ... R&D Consortium Programme - Innovative Processing of Specialties ... Chemical and Engineering Sciences (ICES), the consortium offers ...
(Date:6/19/2013)... 2013 For an eco-friendly selection for ... Baths using metallic beads instead of water. The ... not require germicides. Yet, the bead bath delivers exceptional ... is always ready unlike a water bath, no warm-up ... bath, which eliminates the contamination and maintenance issues related ...
(Date:6/19/2013)... Bellevue, WA (PRWEB) June 19, 2013 ... open an exhibit hall of technology solutions for ... 6:30pm at the Hyatt Regency Bellevue. , ... to the public on Saturday and Sunday, will ... which includes power wheelchairs, communication devices, eyegaze technologies, ...
(Date:6/19/2013)... Miami, FL (PRWEB) June 19, 2013 An ... shed light on the increasing number of uses for probiotics. ... have probiotic qualities, and the associate benefits may beeb listed, ... health, reducing inflammation, and helping clear skin conditions. While the ... News shed light on the the uses of these “miracle” ...
Breaking Biology Technology:Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 2Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 3Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 4Cole-Parmer Introduces Eco-Friendly Waterless Bead Baths 2City of Bellevue, Wash., Welcomes Assistive Technology Exhibit Hall 2Natural Acne Remedy, Probiotic Action Explains the Science behind Using Probiotics for Better Health 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: