Navigation Links
$21.5 million for materials research at the University of Utah
Date:9/9/2011

SALT LAKE CITY, Sept. 8, 2011 The University of Utah is launching a six-year, $21.5 million effort to conduct basic research aimed at developing new materials for uses ranging from faster computers and communications devices to better microscopes and solar cells.

The new Center of Excellence in Materials Research and Innovation is being established and funded for six years by a $12 million grant from the National Science Foundation (NSF), $6.5 million for major equipment from the Utah Science Technology and Research (USTAR) initiative and $3 million from the University of Utah.

The coveted NSF Materials Research Science and Engineering Center grants are obtained only by the nation's best research universities, says Anil Virkar, director of the new center and a University of Utah distinguished professor and chair of materials science and engineering.

"At the federal agency level, this is about the most prestigious award possible," Virkar says. "Securing a grant of this size and scope really inaugurates our academic membership in the Pac-12."

Other universities included in the new round of NSF materials research grants include Yale, Columbia, Cornell, Northwestern and Michigan.

The new Utah center involves more than two dozen researchers from seven departments in the College of Science, College of Engineering and College of Mines and Earth Sciences.

The NSF says the new University of Utah center will focus on "next-generation materials for plasmonics and spintronics."

"We are among the world leaders in these two fields," Virkar says.

The center's two interdisciplinary research groups will focus on those areas:

-- Physicist Brian Saam will lead the organic spintronics research effort, which will work on developing organic semiconductors that can be used to carry and store information not only electronically by exploiting the electrons in atoms, but also "spintronically" by using
'/>"/>

Contact: Lee Siegel
lee.siegel@utah.edu
801-581-8993
University of Utah
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Ohio Third Frontier awards $2.5 million for imaging research in Cleveland
2. Hemophilia research gets NIH boost to a tune of $5.5 million
3. Marine Science Institute receives $7 Million grant to study the impact of the Deepwater Horizon
4. Lawson researchers share in $2.2 million grant
5. How many species on Earth? 8.7 million
6. Not so fast -- researchers find that lasting evolutionary change takes about 1 million years
7. CWRU School of Dental Medicine receives $2.6 million in grants
8. Southampton researchers awarded $28 million to progress pioneering nutrition and respiratory research
9. Mount Sinai receives $3.4 million for largest study of personalized medicine in the clinical setting
10. SPO Secures Equity Line Facility of US$5 Million
11. BUSM professor awarded $13.3 million to study potential treatments to prevent STDs
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: