Navigation Links


American Farmer Announces Episode, Featuring Federal Hybrids, Inc.

8/18/2017
Jupiter, FL (PRWEB) August 18, 2017 Producers of the award winning American Farmer television series proudly announce that they will feature Federal Hybrids, Inc. in an upcoming episode, scheduled to broadcast fourth quarter 2017. American Farmer airs Tuesdays at 8:30aET on RFD-TV. Americ... [Comments]

OAI Introduces Model 800E, Enhanced Mask Aligner

8/18/2017
San Jose, CA (PRWEB) August 18, 2017 OAI, a leading Silicon Valley, CA-based manufacturer of advanced precision Lithography Equipment for the Semiconductor, MEMS, and Microfluidics Industries, announces the new Model 800E front and backside, semi-automatic mask aligner system. This system off... [Comments]

CNA Finance Provides Research Update On Aytu Bioscience And Natesto®

8/17/2017
Coral Springs, FL (PRWEB) August 17, 2017 CNA Finance Chief Research Analyst, Kenny Soulstring, today announced that the stock market news outlet had provided a research update on Aytu Bioscience and cited promising increases in the prescription rates for Natesto®, the company's nasa... [Comments]

Cynvenio and Saint Luke’s Cancer Institute Launch Pilot Study to Evaluate the Potential for Early Detection of Recurrent Breast Cancer Following Therapy

8/17/2017
Westlake Village, CA (PRWEB) August 17, 2017 Cynvenio Biosystems, Inc., a leader in liquid biopsy technology for cancer research and personalized medicine, today announced the launch of a new breast cancer monitoring study in partnership with Saint Luke’s Cancer Institute in Kansas City, Miss... [Comments]

Tunnell Consulting Joins Top Industry Experts at ISPE Conference

8/16/2017
King of Prussia, PA (PRWEB) August 16, 2017 Tunnell Consulting announced today that four of the firm’s thought leaders will be taking part in sessions at the ISPE Annual Meeting and Expo , to be held October 29 through November 1 in San Diego at the Marriott Marquis San Diego Marina. The e... [Comments]

Nanoscience Instruments Expands into ElectroSpinning and ElectroSpraying with Bioinicia

8/16/2017
Phoenix, Arizona (PRWEB) August 16, 2017 Nanoscience Instruments is proud to introduce the Fluidnatek® Electrospinning and Electrospraying line of nanofiber and nanoparticle fabrication instruments from Bioinicia. The electrospinning and electrospraying equipment scales from table-to... [Comments]

Thermo Fisher Scientific Showcases Cell Reprogramming in Treatment-Resistant Prostate Cancer

8/16/2017
Yorba Linda, Ca (PRWEB) August 16, 2017 Recent studies show that cancer cells can resist treatment by changing into a different cell type. Many treatments for specific cancers, such as breast, prostate, or lung, target vital pathways active in healthy tissue. A prominent example of targeted t... [Comments]

Interdependent “Mesh” of Art and Science on Display at Esther Klein Gallery

8/16/2017
Philadelphia, PA (PRWEB) August 16, 2017 While art and science are often thought of as two completely separate modes of thought, they are much more closely connected than one might think. A Mesh Is Also a Snare, a group exhibition presented by the Philadelphia-based artist collective Grizzly... [Comments]

3Bar Biologics Secures $2M To Help Farmers Increase Crop Yields with Naturally Occurring Microbes

8/16/2017
Columbus, OH (PRWEB) August 16, 2017 Today, 3Bar Biologics Inc ., the provider of a beneficial microbe delivery system, announced it has secured $2M in funding from an impressive group of investors, including Rev1 Ventures, Maumee Ventures, Ohio TechAngel Funds, Queen City Angels, Carmen Inn... [Comments]

Successful FDA Inspection at AXIS Clinicals USA

8/16/2017
Dilworth, MN (PRWEB) August 16, 2017 We are proud to announce the successful completion of our third U.S. Food and Drug Administration (FDA) inspection at our Dilworth, MN site. The inspection took place Monday, July 31st through Friday, August 4th, 2017. No 483 was issued. This inspection wa... [Comments]

[next]
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: