Navigation Links


Chicken Anti-HOXC11 Polyclonal Antibody, Unconjugated from ProSci, Inc

Description:HOXC11 Antibody...
Company:ProSci, Inc

Rhodamine 110 (Fluorescence Reference Standard) from AnaSpec

Description:pH-insensitive fluorescence (pH 2-12)...
Company:AnaSpec

Chicken Anti-HOXC11 Polyclonal Antibody, Unconjugated from ProSci, Inc

Description:HOXC11 Antibody...
Company:ProSci, Inc

Chicken Anti-HOXC11 Polyclonal Antibody, Unconjugated from ProSci, Inc

Description:HOXC11 Antibody...
Company:ProSci, Inc

Mouse Anti-Mouse MMP-14, catalytic domain Monoclonal Antibody, Unconjugated, Clone LEM-2/15.8 from CHEMICON

Description:Anti-MMP-14, catalytic domain, clone LEM-2/15.8 Immunogen: Synthetic peptide: amino acid sequence 218-233 within the catalytic domain Available Date: 38579...
Company:CHEMICON

Mouse Anti-Human PPOX Monoclonal Antibody, Unconjugated, Clone 2F10 from ABR-Affinity BioReagents

Description:PPOX Immunogen: PPOX (AAH02357, 378 a.a. ~ 478 a.a) partial recombinant protein with GST tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Mouse MMP-14, catalytic domain Monoclonal Antibody, Unconjugated, Clone LEM-2/15.8 from CHEMICON

Description:Anti-MMP-14, catalytic domain, clone LEM-2/15.8 Immunogen: Synthetic peptide: amino acid sequence 218-233 within the catalytic domain Available Date: 38579...
Company:CHEMICON

Rabbit Anti-Raf1 Polyclonal Antibody, Unconjugated from Abcam

Description:Rabbit polyclonal to Raf1 ( Abpromise for all tested applications). entrezGeneID: 5894 SwissProtID: P04049...
Company:Abcam

Rabbit Anti-Human MMP-19 (RASI), carboxy terminal region, Antibody, Unconjugated from CEDARLANE Laboratories Limited

Description:Anti-MMP-19 (RASI), carboxy terminal region; rabbit host...
Company:CEDARLANE Laboratories Limited

Mouse Anti-Human KRIT1 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:KRIT1 Immunogen: KRIT1 (NP_004903, 637 a.a. ~ 737 a.a) partial recombinant protein with GST tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents
[previous] [next]
(Date:7/20/2017)... , July 20, 2017 Delta (NYSE: DAL ... board any Delta aircraft at Reagan Washington National Airport (DCA). ... Delta launches biometrics to ... Delta,s biometric ... Sky Club is now integrated into the boarding process to allow ...
(Date:5/16/2017)... 2017  Veratad Technologies, LLC ( www.veratad.com ), an ... identity verification solutions, announced today they will participate as ... 15 thru May 17, 2017, in Washington ... Center. Identity impacts the lives of ... quickly evolving digital world, defining identity is critical to ...
(Date:4/18/2017)... Inc., a global expert in SoC-based imaging and computing solutions, has ... features the company,s hybrid codec technology. A demonstration utilizing TeraFaces ® ... be showcased during the upcoming Medtec Japan at Tokyo Big Sight ... Las Vegas Convention Center April 24-27. ... Click here for an image of the ...
Breaking Biology News(10 mins):
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... a partial recombinant NFKBIB. Immunogen: ... partial recombinant protein with GST tag. ... Accession: BC015528 Protein Accession ... 604495, GeneID: 4793 ...
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:10/12/2017)... ... ... AMRI, a global contract research, development and manufacturing organization ... quality of life, will now be offering its impurity solutions as a stand-alone ... for all new drug products, including the finalization of ICH M7 earlier this ...
(Date:10/11/2017)... USA (PRWEB) , ... October 11, 2017 , ... ComplianceOnline’s ... take place on 7th and 8th June 2018 in San Francisco, CA. The Summit ... as well as several distinguished CEOs, board directors and government officials from around the ...
(Date:10/11/2017)... ... October 11, 2017 , ... A new study published ... frozen and fresh in vitro fertilization (IVF) transfer cycles. The multi-center ... success. , After comparing the results from the fresh and frozen transfer cohorts, ...
(Date:10/10/2017)... ... ... Dr. Bob Harman, founder and CEO of VetStem Biopharma, Inc. spent ... entitled “Stem Cells and Their Regenerative Powers,” was held on August 31st, 2017 ... joined by two human doctors: Peter B. Hanson, M.D., Chief of Orthopedic Surgery, Grossmont ...
Breaking Biology Technology: